<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3889 CA9081 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 D4T 43
3 3TC+AZT 17
4 3TC+AZT+RTV 48
5 3TC+AZT+RTV+SQV 43
6 3TC+D4T+IDV 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, Q151M, M184V, T215F K219Q     K20R, T69N, V90I, I135V, S162A, D177E, G196E, E203D  
>CA9081| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIDELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53FL, G73S L10I, G16A, L63P, A71V  
>CA9667| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGLVKVRQYD
QIPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005