<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0086 0086b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 24
2 Unknown 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, L74LV   K103N, G190S   S68SG, V90I, G196GR, R211K, V245L  
>0086b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVSSDLEIRQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R57RK, I62IV, I64V  
>0086b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYDQVL
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003