<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0074 0074c U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 72
2 3TC+AZT+NFV 17
3 None 3
4 3TC+AZT+NFV 14
5 None 2
6 3TC+AZT+NFV 2
7 Unknown 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV, L210LW, T215TNSY   L100I, K103N   V60VI, V118VI, I142V, A158AS, S162SAGT, P170PT, N175NH, Q197QR, T200TA, Q207QE, R211K, E224EG, L228LR, V245E K65KQ
>0074c| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKQKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
SIFQTSMTKILETFRKQHPDIVIYQYVDDLYVGSDLEIGRHRAKIEELREHLWKWGFYTP
DKKHQKGPPFRWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36MI, R41RK, F99X  
>0074c| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNL

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003