<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3441 3441b U.S. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, M36L, R41K, L63P, H69K, I93L  
>3441b| codons 4-99
TLWQRPLVSIKVGGQTREALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39EG, S48T, A98AS, K122E, I135R, K173A, Q174K, D177E, I202V, Q207K, R211K, V245Q  
>3441b| codons 38-246
CGEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLEIGQHRTKVEELRKHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQL

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003