<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3341 3341b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225H K20R, G196E, T200I, R211K, K259X  
>3341b| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRIKIEELRQHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R41K, K45R, I62V, I93L  
>3341b| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPRMIGGIGGFIKVRQYD
QVLIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003