<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1145 1145b U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 25
2 None 7
3 D4T+DDI+NFV 42
4 None 6
5 D4T+DDI+NFV 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI   W6WR, L10I, E35D, M36MI, D60DE, I62IV, L63T, E65D, A71AV  
>1145b| codons 4-99
TLRQRPIVTIKIGGQLKEALLDTGADDTILEDINLPGRWKPKMIGGIGGFIKVRQYEQVT
IDICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67DG     K104KQ, V245Q  
>1145b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKQSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003