Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JIDP7 | JIDP7W104 | U.S. | 1993 | HIV1 | B | PBMC | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | None | 52 |
| 2 | AZT+DDI | 104 |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| D67N, K70R, T215F | K219Q | V35I, K101Q, K104KN, K122E, I135V, R211K |
| >JIDP7W104| codons 26-245 LTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQ DFWEVQLGIPHPAGLQKKNSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQ YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEEL RQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIV |
References
| Author | Title | Citation |
| Shafer, RW | Drug resistance and heterogeneous long-term virologic responses of human immunodeficiency virus type 1 - infected subjects to zidovudine and didanosine combination therapy. | J Infect Dis, 1995 |
| Shafer, RW | Combination therapy with zidovudine and didanosine selects for drug-resistant human immunodeficiency virus type 1 strains with unique patterns of pol gene mutations. | J Infect Dis, 1994 |
| Gonzales, MJ | Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. | AIDS, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |