<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_7259 7259b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90LM   W6WR, I15V, K20T, E35D, M36I, D60E, I62V, V82I  
>7259b| codons 1-99
PQITLRQRPLVTIKVGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFLKVRQYE
QVLIEICGHKAIGTVLVGPTPINIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D121C, K122E, K166R, E204Q, Q207E, R211K, F214L Q182QL
>7259b| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YLYMDDLYVGSDLEIGQHRTKIEQLREHLLKWGLTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003