<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1478 1478b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 8
2 None 3
3 3TC+D4T+NFV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, E35D, N37S, L63P, I64V, V82VI, I93L  
>1478b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVVEDMSLPGRWKPKMIGGIGGFIKVRQYDQIP
VEICGHKAIGTVLVGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K102Q, D123DG, S134SG, S162C, E203D, R211K F87FS, V111VL
>1478b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDSWEVQLGIPHP
AGLKQKKSVTVLDLGDAYFSVPLDKGFRKYTAFTIPGINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003