<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1486 1486c U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 28
2 3TC+AZT+NFV 94

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, K14R, E35ED, M36I, R41K, K45R, I62V, L63S, I64MV  
>1486c| codons 4-99
TLWQRPIVTVRIGGQLKEALLDTGADNTVLEDINLPGKWKPRMIGGIGGFIKVRQYDQVS
VEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I37X, I135IL, R211K, V245M  
>1486c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003