<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0562 0562a U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T69S, D121H, K122E, I142V, S162C, E169D, D177E, I178M, R211RK  
>0562a| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37ND, R41RK, R57K, L63P, C67S, H69HY, K70KR, V77I  
>0562a| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFIKVKQYDQIP
IEISGYRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003