<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0569 0569a U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37D, R41K, R57RK, L63S, I64L, A71V, I72AT, V77VI, I93L  
>0569a| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMDLPGKWKPKMIGGIGGFIKVKQYDQIS
LEICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215D   V179E V60I, D123E, S162C, G196E, T200A, Q207E, V245E  
>0569a| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIEIYQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003