<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0544 0544c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 30
2 D4T+DDI+EFV 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103N   I37X, A98S, D123E, I135T, D177E, T200A, Q207E, R211RK, V245L  
>0544c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PSGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN   T12P, K14R, Q18L, K20KT, R41K, L63P, V77VI, I93L  
>0544c| codons 4-99
TLWQRPLVPIRIGGLLTEALLDTGADNTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003