<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0555 0555a U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I Q18QE, L19I, E35ED, N37AGST, R41RK, K45KR, L63P, V77I, I93L  
>0555a| codons 4-99
TLWQRPLVTIKIGGEIKEALLDTGADDTVIEDMTLPGKWKPRMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K64KR, A98S, D123E, I135IT, D177DE, T200TA, Q207E, R211K T84TP, V111VL
>0555a| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRPQDFWEVQLGIPHP
SGLKKKKSVTVLDLGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003