<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3616 3616b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103S   S68SG, K122E, Q174QR, D177DE, I178M, D192N, G196GV, T200TA, Q207E, R211K, V245M  
>3616b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEMVIYQYMDDLYVGSNLEIVQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L76LI, N88D L10I, K14KM, L63A, A71AV, G73GV, V77I, I93L  
>3616b| codons 4-99
TLWQRPIVTIMIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIA
IEICGHKVIVTVIIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003