<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1768 1768b U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 20
2 None 2
3 3TC+AZT+NFV 35
4 None 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K101Q, D123E, E138EA, D177E, V179I, V245M  
>1768b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33I L19Q, M36I, I62V, L63P, K70R, A71T, I72T  
>1768b| codons 4-99
TLWQRPLVTIKIGGQQKEALLDTGADDTVIEEINLPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHRTTGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003