<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3628 3628b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   L100I, K103N, G190A   F87L, D121H, K122E, Q197L, T200E, E204K, R211K, F214L, V245M  
>3628b| codons 39-245
TEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDLWEVQLGIPHPA
GIKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVIYQYMDDLYVASDLEIGLHREKIEKLRQHLLKWGLTTPD
KKHQKEPPFLWMGYELHPDKWTVQPIM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16X, P39A, R41K, L63P, V77I, I93L  
>3628b| codons 4-99
TLWQRPLVTIKIWGQLKEALLDTGADDTVLEEMNLAGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003