<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1759 1759b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219R K101P, K103N   T39E, E44D, V118I, K122E, K173T, Q174K, N175Y, G196E, Q207K, R211E, D218E  
>1759b| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKYPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRKHLWEWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, I54L, I84V, L90M L33F, T74P, N88D L10R, T12I, I13V, N37D, I62V, L63P, A71V, I93L  
>1759b| codons 1-99
PQITLWQRPRVIVKIGGQLKEALLDTGADNTVFEEMDLPGRWKPKLIGGIGGFLKVRQYD
QVPIEICGHKVIGPVLVGPTPVNVIGRDLMTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003