<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1346 1346c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 22
2 3TC+AZT+NFV 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L10V, E35D, M36I, N37T, L38LM, I62V, L63P, I93L  
>1346c| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADNTVLEDITMPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V       I37X, I135IT, S162A, Q197K, R211K, V245K  
>1346c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGKHRTKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003