<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_6200 6200b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 6
2 D4T+NFV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI   I13V, G16E, E35D, M36I, N37NK, R41K, K45R, L63T, I64V, E65D, I72T, V77I, Q92QK, I93IL  
>6200b| codons 4-99
TLWQRPLVTVKIEGQLKEALLDTGADDTVLEDIKLPGKWKPRIIGGIGGFIKVRQYDQIT
VDICGHKATGTVLIGPTPVNIIGRNLLTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135T, R211REGK, V245Q  
>6200b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003