<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA478 CA899 U.S. 1993 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+DDI 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F77L, F116Y     V35I, R83K, A158S, R211K, V245E  
>CA899| codons 26-245
LTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDLRELNKKTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQ
YNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEEL
RQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIE

References
Author Title Citation
Shafer, RW Drug resistance and heterogeneous long-term virologic responses of human immunodeficiency virus type 1 - infected subjects to zidovudine and didanosine combination therapy. J Infect Dis, 1995
Shafer, RW Combination therapy with zidovudine and didanosine selects for drug-resistant human immunodeficiency virus type 1 strains with unique patterns of pol gene mutations. J Infect Dis, 1994
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005