<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1569 1569b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 5
2 None 3
3 D4T+DDI+EFV 38
4 3TC+AZT+NFV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R A62AV, V75VA L100I, K103N   I37X, K122V, D123N, I135IT, T139S, S162SC, D177E, G196GE, T200TA, R211RK, F214FL  
>1569b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFVIKRKDSTKWRKLADFRELNKRTQDFWEVQLGIPH
PAGIKKNKSVTVLDVGDAYFSVPLDVNFRKYTAFTIPSTNNESPGIRYQYNVLPQGWKGS
PAIFQCSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIEQHRAKIEELRQHLLKWGLTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63LP  
>1569b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003