<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2848 2848d U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 25
2 3TC+AZT+EFV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39S, L63P, I72V, V77I, I93IL  
>2848d| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67DG L100LI, K103N K238KN I37X, K122E, D123N, A158T, D177E, Q207E  
>2848d| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGIKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PTIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFTT
PDKKHQKEPPFLWMGYELHPDNWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003