<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1027 1027c U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 24
2 D4T+DDI+EFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225PH A98S, V118I, K122E, T200A, F214L, V245E  
>1027c| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L63P, I64V, A71AV, V77I, I93L  
>1027c| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
VEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003