<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2774 2774a U.S. 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P9X, E35D, M36I, R41K, R57K, I62V, L63I, H69K, L89IM, F99X  
>2774a| codons 5-99
LWQRTLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQVII
EICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40D, V60I, K64R, D121H, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, T200TA, Q207A, R211S, V245M D76DN, D110DN, V111VL, D113DN
>2774a| codons 38-246
CTDMEKEGKISKIGPENPYNTPIFAIRKKDSTKWRKLVNFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLNLGNAYFSVPLHESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRSKNPEIIIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIML

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003