<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2757 2757b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   I13V, L19I, K20T, E35D, N37D, R57K, L63P, I64V, V77I  
>2757b| codons 1-99
PQITLWQRPLVTVKIGGQITEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V35IT, V60I, R83K, I135T, N175H, G196E, T200A, R211K, L228H, T286A, A288S, V292I A267AS
>2757b| codons 1-295
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQHPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWSSQIYAGIKVKQLCKLLRGAKSLTEIIPL

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003