<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2749 2749b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV+NFV 24
2 None 6
3 3TC+AZT+EFV+NFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N V108I K32Q, E36ED, W88S, K101Q, D123E, I135K, S163SC, K166R, D177E, I202V, R211K, H221Y, V245E R143RS
>2749b| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIQALVDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLQKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSKNNETPGISYQYNVLPQGWKGSPAIFQSCMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12KN, K43KN, L63P  
>2749b| codons 1-99
PQITLWQRPLVNIKIGGQLKEALLDTGADDTVLEEMNLPGRWNPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003