<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2776 2776a U.S. 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15V, G17GE, E35D, M36I, R41K, R57K, Q61N, I72V, V77VI, V82I, L89M, I93L  
>2776a| codons 4-99
TLWQRPLVTIRVGEQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIL
IEICGHKAVGTVLIGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K64KR, R83RK, D86DN, V118I, K122E, I135T, R211RK, F214L  
>2776a| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKKTQNFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003