<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3258 3258a U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215D   V108IK K82KR, A98AP, K122Q, K166R, D177E, I202V, L210F, V245T H96HN
>3258a| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPNP
PGLKKKKSVTKLDVGDAYFSVPLDQDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLFRWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, P39PL, V77I, I93L  
>3258a| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLLGRWKPKMIGGIGGFIKVRQYDQIL
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003