<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_6265 6265b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 3
2 None 5
3 D4T+DDI+NFV 14
4 3TC+AZT+EFV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, N37S, R41K, L63P, V82I, I93L  
>6265b| codons 10-99
LVTIKIGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGH
KAIGTVLVGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S162C, Q207E, V245E  
>6265b| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGK

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003