<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0870 0870b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 33
2 3TC+AZT+EFV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75T     K64KR, A98S, K122E, D123N, K166R, K173S, Q174R, T200I, R211K, I257L, A272P, K277R, T286A, I293V, E297K R172S
>0870b| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFSSRNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10LF N37A, K43KN, L63P, V77VI  
>0870b| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMALPGRWNPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003