<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1082 1082d U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 22
2 3TC+AZT+NFV 32
3 IDV+RTV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M F116Y K103N, Y188L   I37X, V60I, S68SR, R83K, K102R, D123E, I135V, R172K, I178L, R211RK, V245D  
>1082d| codons 37-247
VCTEMEKEGKISKIGPENPYNTPIFAIKRKDRTKWRKLVDFRELNKKTQDFWEVQLGIPH
PAGLKRNKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGS
PAIFQSSMTKILEPFKKQNPDLVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIDLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, L90LIM   L10I, E35D, L38LW, K45KR, L63P, I64L, H69Q, A71AT  
>1082d| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADNTVLEDMNWPGRWKPRMIGGIGGFIKVRQYDQIP
LEICGQKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003