<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1082 1082b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N, Y188L   I37X, V60I, R83K, K102KR, D123E, I135IV, R172RK, I178L, Q207QE, R211RK, V245D  
>1082b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPH
PAGLKRNKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGS
PAIFQSSMTKILEPFKKQNPDLVIYQYMDDLLVGSDLEIGQHRTKIEELREHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIDLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, L63P, I64L, H69Q  
>1082b| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYDQIP
LEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003