<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_4002 4002b U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     S48T, K122Q, S162H, D177E, V179I, E194EG, G196E, Q207G, R211K, P243A  
>4002b| codons 38-247
CTEMEKEGKITKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDQDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQHSMTKILEPFRKQNPEIIIYQYVDDLYVGSDLGIEQHRTKIEELRGHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQAIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20T, M36I, R41K, D60E, I62V, I64V, I93L  
>4002b| codons 4-99
TLWQRPLVTVRIGGQLTEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQVL
VEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003