<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1825 1825c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 22
2 None 3
3 D4T+DDI+EFV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, I62IV, L63R, K70I, V77I  
>1825c| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQVR
IEICGHIAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VI L100LI, K103N   I37X, K122KE, I142V, I178IM, Q207E, R211RKQ  
>1825c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPH
PAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLQWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003