<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2043 2043b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 30
2 None 14
3 3TC+AZT+LPV 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, K20R, M36I, N37S, I62V, L63H, I64V  
>2043b| codons 4-99
TLWQRPLVAIKIGGQLREALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYDQVH
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, W88WC, V118VI, I135IV, A158S, K166R, I180V, I202V, R211K  
>2043b| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTRILEPFRKQNPDIVVYQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003