<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2105 2105b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19LI, M36MI, N37D, I62V, L63S, Q92K  
>2105b| codons 4-99
TLWQRPLVTIKIGGQIKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYDQVS
IEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V118I, K122KR, D123E, I142V, T165I, Q174R, T200A, R211G, F214L  
>2105b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDREFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKRNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLGWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003