<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0930 0930b U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 99

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67DG, K70N G190S   V35M, S68SG, R83K, K122E, R211K, L228R, V245E, T286A, P294T, E297R  
>0930b| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGGTNWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVITLTREAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, L63P  
>0930b| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003