<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0902 0902b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   K20R, E35D, M36MV, N37ND, L63P, V77I, I93L  
>0902b| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDVDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A98S, K166KR, R211RG, V245I, I274IV, T286X, I293V  
>0902b| codons 1-297
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYAGVKVKQLCKLLRGSKALTEVVPLTE

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003