<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0901 0901d U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 16
2 D4T+DDI+EFV 26
3 3TC+APV+D4T+EFV+RTV 40
4 3TC+ABC+APV+EFV+RTV 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L33F, N83D L10I, K20R, E35N, M36L, N37D, I62V, L63P, A71V, L89I  
>0901d| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFENLDLPGRWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVIGTVLVGPTPVDVIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M K101E, G190S   P4PS, E6KR, V35I, T39S, K43Q, E44D, D121DH, K122E, D123X, V179I, Q197K, T200A, I202V, H208Y, R211K, H221Y, A288S, I293V, E297K  
>0901d| codons 1-298
PISSIRTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICSELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEXFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVSSDLEIGKHRAKVEELRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTKE

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003