<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0901 0901c U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 16
2 D4T+DDI+EFV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M V106A, G190S   T39S, K43Q, E44D, V118I, K122E, D123N, V179I, Q197K, T200A, I202V, H208Y, R211K, H221Y R83EK
>0901c| codons 38-247
CSELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVSSDLEIGKHRAKVEELRQYLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M N83D L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V  
>0901c| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVIGTVLVGPTPVDVIGRNLMTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003