<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0901 0901b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M N83D L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V  
>0901b| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPVDVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184MV, L210W, T215Y   G190S   E6K, V35I, T39S, K43Q, E44D, R83K, K104N, K122E, V179I, Q197K, T200A, I202V, H208Y, R211K, H221Y, A288S, I293V, E297K  
>0901b| codons 1-298
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICSELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKKTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVSSDLEIGKHRAKVEELRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTKE

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003