<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PO-Pt21 Orl21-W300 Italy 1996 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 300

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q     T39A, D123E  
>Orl21-W300| codons 3-220
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPVFA
IKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
EFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFVTPDQK

References
Author Title Citation
Orlandi, P Analysis of HIV-1 reverse transcriptase gene mutations in infected children treated with zidovudine. JAIDS, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005