<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PO-Pt20 Orl20-W232 Italy 1991 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 232

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y       K49R, E53D, T69S, A98S, D123E  
>Orl20-W232| codons 3-220
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPDNPYNTPVFA
IKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDK
EFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKK

References
Author Title Citation
Orlandi, P Analysis of HIV-1 reverse transcriptase gene mutations in infected children treated with zidovudine. JAIDS, 1998
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005