<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0615 0615a U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, T69S, K104R, I135L, S162C, T200EQ  
>0615a| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRQKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36MI, L63LP, I64IV L19AITV
>0615a| codons 6-99
WQRPLVTIKVGGQVKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQIPVE
ICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003