<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0601 0601b U.S. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+NFV 30
2 None 5
3 D4T+DDI+EFV+NFV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML   T12S, I15V, L19I, M36I, N37S, R41K, H69K, L89M, I93L  
>0601b| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEISLPGKWKPKLIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K102Q, K122E, E138A, S162C, E169EA, K173A, P176Q, T200A, Q207E, V245L, E248D, A272P, K277R, T286A, E291D, V292I, I293V  
>0601b| codons 1-294
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILAPFRAQNQDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003