<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1209 1209c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 21
2 3TC+D4T+EFV 36
3 3TC+AZT+NFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV K103N P225H I135V, D177G, I178M, R211K, V245K  
>1209c| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, M36MI, N37S, R41RK, L63P  
>1209c| codons 6-99
WQRPLVTVRIGGQLKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQIPIE
ICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003