<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3104 3104b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   T39S, R83K, K122E, S162C, S163T, Q207E, E248ED, A272P, T286A, I293IL, E297T  
>3104b| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCTMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVLPLTTEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN   I15V, E35D, M36I  
>3104b| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003