<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0245 0245b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+NFV 6
2 None 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37X, A98S, K122AP, D177E, I178LM, T200TS, Q207QE, R211RK, P243S  
>0245b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PSGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRSKIEELREHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQSIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63LP, I64IL, I72EV, V77I, I93L  
>0245b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
LEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003