<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0308 0308b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T 7
2 Unknown 51
3 D4T+DDI+EFV 25
4 3TC+D4T+EFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I I37X, S48T, K122Q, I135L, T139A, I142T, S162A, D177G, V179I, R211K  
>0308b| codons 37-247
VCTEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKNKSVTILDVGDAYFSVPLDQDFRKYTAFTIPSLNNEAPGTRYQYNVLPQGWKGS
PAIFQASMTKILEPFRKQNPGIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, L33V, L63Q, I64V  
>0308b| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYDQIQ
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003